Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) |
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) |
Protein automated matches [190079] (9 species) not a true protein |
Species Bacillus cereus [TaxId:1396] [187455] (15 PDB entries) |
Domain d4c09a_: 4c09 A: [259056] automated match to d2m5da_ complexed with gol, so4, zn |
PDB Entry: 4c09 (more details), 1.2 Å
SCOPe Domain Sequences for d4c09a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c09a_ d.157.1.1 (A:) automated matches {Bacillus cereus [TaxId: 1396]} ektviknetgtisisqlnknvwvhtelgsfdgeavpsnglvlntskglvlvdsswddklt keliemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeepl gdlqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvada yvnewstsienvlkryrninavvpghgevgdkglllhtldllk
Timeline for d4c09a_: