Lineage for d4c09a_ (4c09 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996833Protein automated matches [190079] (12 species)
    not a true protein
  7. 2996836Species Bacillus cereus [TaxId:1396] [187455] (15 PDB entries)
  8. 2996838Domain d4c09a_: 4c09 A: [259056]
    automated match to d2m5da_
    complexed with gol, so4, zn

Details for d4c09a_

PDB Entry: 4c09 (more details), 1.2 Å

PDB Description: crystal structure of the metallo-beta-lactamase bcii
PDB Compounds: (A:) Beta-lactamase 2

SCOPe Domain Sequences for d4c09a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c09a_ d.157.1.1 (A:) automated matches {Bacillus cereus [TaxId: 1396]}
ektviknetgtisisqlnknvwvhtelgsfdgeavpsnglvlntskglvlvdsswddklt
keliemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeepl
gdlqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvada
yvnewstsienvlkryrninavvpghgevgdkglllhtldllk

SCOPe Domain Coordinates for d4c09a_:

Click to download the PDB-style file with coordinates for d4c09a_.
(The format of our PDB-style files is described here.)

Timeline for d4c09a_: