Lineage for d3wtua_ (3wtu A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767925Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2768348Family b.2.5.6: RUNT domain [81318] (2 proteins)
    automatically mapped to Pfam PF00853
  6. 2768349Protein Acute myeloid leukemia 1 protein (AML1), RUNT domain [49439] (2 species)
    synonym: core binding factor alpha, cbfa
  7. 2768363Species Mouse (Mus musculus) [TaxId:10090] [63684] (14 PDB entries)
    almost identical sequence to the human protein
  8. 2768377Domain d3wtua_: 3wtu A: [259053]
    Other proteins in same PDB: d3wtub_, d3wtuc_, d3wtug_
    automated match to d1hjbc_
    protein/DNA complex

Details for d3wtua_

PDB Entry: 3wtu (more details), 2.7 Å

PDB Description: crystal structure of the complex comprised of ets1 (v170a), runx1, cbfbeta, and the tcralpha gene enhancer dna
PDB Compounds: (A:) runt-related transcription factor 1

SCOPe Domain Sequences for d3wtua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wtua_ b.2.5.6 (A:) Acute myeloid leukemia 1 protein (AML1), RUNT domain {Mouse (Mus musculus) [TaxId: 10090]}
gelvrtdspnflcsvlpthwrcnktlpiafkvvakgdvpdgtlvtvmagndenysaelrn
ataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitadgprepr

SCOPe Domain Coordinates for d3wtua_:

Click to download the PDB-style file with coordinates for d3wtua_.
(The format of our PDB-style files is described here.)

Timeline for d3wtua_: