SCOPe 2.05: Domain d4u0rc2: 4u0r C:112-217

Lineage for d4u0rc2 (4u0r C:112-217)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (15 PDB entries)

8. Domain d4u0rc2: 4u0r C:112-217 [259034]
   automated match to d1h3pl2

Details for d4u0rc2

PDB Entry: 4u0r, 2.3 Å

PDB Description: plasmodium falciparum reticulocyte-binding protein homologue 5 (pfrh5) bound to monoclonal antibody 9ad4

PDB Compounds: (C:) Monoclonal antibody 9AD4 light chain

SCOPe Domain Sequences for d4u0rc2:

Sequence; same for both SEQRES and ATOM records:

>d4u0rc2 b.1.1.0 (C:112-217) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d4u0rc2:

• d4u0rc2 first appeared in SCOPe 2.04
  
• d4u0rc2 appears in SCOPe 2.06
  
• d4u0rc2 appears in the current release, SCOPe 2.08