PDB entry 4u0r

View 4u0r on RCSB PDB site
Description: Plasmodium falciparum reticulocyte-binding protein homologue 5 (PfRH5) bound to monoclonal antibody 9AD4
Class: immune system
Keywords: malaria erythrocyte invasion antibody-mediated inhibition, immune system
Deposited on 2014-07-14, released 2014-08-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-12-03, with a file datestamp of 2014-11-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.223
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Reticulocyte binding protein 5
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2L3N7
      • conflict (215)
  • Chain 'B':
    Compound: Monoclonal antibody 9AD4 heavy chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • PDB 4U0R
  • Chain 'C':
    Compound: Monoclonal antibody 9AD4 light chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • PDB 4U0R
    Domains in SCOPe 2.05: d4u0rc1, d4u0rc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >4u0rC (C:)
mvstpqflvfllfwipasrgdivltqspaslavslgqratiscrasesveyygtslmqwf
qqkpgqpprllihgasnvqsgvparfsgsgsgtdfslnihpveeddfamyfcqqstkvpw
tfgggtkleikradaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserq
ngvlnswtdqdskdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

    Sequence, based on observed residues (ATOM records): (download) 
    >4u0rC (C:)
divltqspaslavslgqratiscrasesveyygtslmqwfqqkpgqpprllihgasnvqs
gvparfsgsgsgtdfslnihpveeddfamyfcqqstkvpwtfgggtkleikradaaptvs
ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
stltltkdeyerhnsytceathktstspivksfnrne