SCOPe 2.05: Domain d4bz3a_: 4bz3 A:

Lineage for d4bz3a_ (4bz3 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein automated matches [190079] (9 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [189349] (20 PDB entries)

8. Domain d4bz3a_: 4bz3 A: [258890]
   automated match to d4fr7a_
   complexed with fmt, na, zn

Details for d4bz3a_

PDB Entry: 4bz3, 1.29 Å

PDB Description: crystal structure of the metallo-beta-lactamase vim-2

PDB Compounds: (A:) beta-lactamase vim-2

SCOPe Domain Sequences for d4bz3a_:

Sequence; same for both SEQRES and ATOM records:

>d4bz3a_ d.157.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnrs

Timeline for d4bz3a_:

• d4bz3a_ first appeared in SCOPe 2.04
  
• d4bz3a_ appears in SCOPe 2.06
  
• d4bz3a_ appears in the current release, SCOPe 2.08