Lineage for d4bz3a_ (4bz3 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1679369Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1679370Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1679371Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 1679510Protein automated matches [190079] (7 species)
    not a true protein
  7. 1679544Species Pseudomonas aeruginosa [TaxId:287] [189349] (15 PDB entries)
  8. 1679546Domain d4bz3a_: 4bz3 A: [258890]
    automated match to d4fr7a_
    complexed with fmt, na, zn

Details for d4bz3a_

PDB Entry: 4bz3 (more details), 1.29 Å

PDB Description: crystal structure of the metallo-beta-lactamase vim-2
PDB Compounds: (A:) beta-lactamase vim-2

SCOPe Domain Sequences for d4bz3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bz3a_ d.157.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnrs

SCOPe Domain Coordinates for d4bz3a_:

Click to download the PDB-style file with coordinates for d4bz3a_.
(The format of our PDB-style files is described here.)

Timeline for d4bz3a_: