Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries) |
Domain d3wexg1: 3wex G:1-82 [258586] Other proteins in same PDB: d3wexa2, d3wexc2, d3wexe2, d3wexg2 automated match to d1f3ja2 complexed with nag |
PDB Entry: 3wex (more details), 2.4 Å
SCOPe Domain Sequences for d3wexg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wexg1 d.19.1.0 (G:1-82) automated matches {Human (Homo sapiens) [TaxId: 9606]} ikadhvstyamfvqthrptgefmfefdedeqfyvdldkketvwhleefgrafsfeaqggl aniailnnnlntliqrsnhtqa
Timeline for d3wexg1: