PDB entry 3wex

View 3wex on RCSB PDB site
Description: Crystal structure of HLA-DP5 in complex with Cry j 1-derived peptide (residues 214-222)
Class: immune system
Keywords: Immunoglobulin Fold, Antigen Presentation, T Cell Receptor, Cell Surface, IMMUNE SYSTEM
Deposited on 2013-07-16, released 2014-07-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-26, with a file datestamp of 2017-04-21.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class II antigen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wexa1, d3wexa2
  • Chain 'B':
    Compound: MHC class II antigen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot I2FL84 (25-208)
      • expression tag (0-8)
      • expression tag (23-24)
  • Chain 'C':
    Compound: MHC class II antigen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wexc1, d3wexc2
  • Chain 'D':
    Compound: MHC class II antigen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot I2FL84 (25-208)
      • expression tag (0-8)
      • expression tag (23-24)
  • Chain 'E':
    Compound: MHC class II antigen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wexe1, d3wexe2
  • Chain 'F':
    Compound: MHC class II antigen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot I2FL84 (25-208)
      • expression tag (0-8)
      • expression tag (23-24)
  • Chain 'G':
    Compound: MHC class II antigen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wexg1, d3wexg2
  • Chain 'H':
    Compound: MHC class II antigen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot I2FL84 (25-208)
      • expression tag (0-8)
      • expression tag (23-24)
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wexA (A:)
    ikadhvstyamfvqthrptgefmfefdedeqfyvdldkketvwhleefgrafsfeaqggl
    aniailnnnlntliqrsnhtqaandppevtvfpkepvelgqpntlichidrffppvlnvt
    wlcngepvtegvaeslflprtdysfhkfhyltfvpsaedvydcrvehwgldqpllkhwea
    qsgpssgenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wexA (A:)
    ikadhvstyamfvqthrptgefmfefdedeqfyvdldkketvwhleefgrafsfeaqggl
    aniailnnnlntliqrsnhtqaandppevtvfpkepvelgqpntlichidrffppvlnvt
    wlcngepvtegvaeslflprtdysfhkfhyltfvpsaedvydcrvehwgldqpllkhwea
    q
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3wexC (C:)
    ikadhvstyamfvqthrptgefmfefdedeqfyvdldkketvwhleefgrafsfeaqggl
    aniailnnnlntliqrsnhtqaandppevtvfpkepvelgqpntlichidrffppvlnvt
    wlcngepvtegvaeslflprtdysfhkfhyltfvpsaedvydcrvehwgldqpllkhwea
    qsgpssgenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wexC (C:)
    ikadhvstyamfvqthrptgefmfefdedeqfyvdldkketvwhleefgrafsfeaqggl
    aniailnnnlntliqrsnhtqaandppevtvfpkepvelgqpntlichidrffppvlnvt
    wlcngepvtegvaeslflprtdysfhkfhyltfvpsaedvydcrvehwgldqpllkhwea
    q
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3wexE (E:)
    ikadhvstyamfvqthrptgefmfefdedeqfyvdldkketvwhleefgrafsfeaqggl
    aniailnnnlntliqrsnhtqaandppevtvfpkepvelgqpntlichidrffppvlnvt
    wlcngepvtegvaeslflprtdysfhkfhyltfvpsaedvydcrvehwgldqpllkhwea
    qsgpssgenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wexE (E:)
    ikadhvstyamfvqthrptgefmfefdedeqfyvdldkketvwhleefgrafsfeaqggl
    aniailnnnlntliqrsnhtqaandppevtvfpkepvelgqpntlichidrffppvlnvt
    wlcngepvtegvaeslflprtdysfhkfhyltfvpsaedvydcrvehwgldqpllkhwea
    q
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3wexG (G:)
    ikadhvstyamfvqthrptgefmfefdedeqfyvdldkketvwhleefgrafsfeaqggl
    aniailnnnlntliqrsnhtqaandppevtvfpkepvelgqpntlichidrffppvlnvt
    wlcngepvtegvaeslflprtdysfhkfhyltfvpsaedvydcrvehwgldqpllkhwea
    qsgpssgenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wexG (G:)
    ikadhvstyamfvqthrptgefmfefdedeqfyvdldkketvwhleefgrafsfeaqggl
    aniailnnnlntliqrsnhtqaandppevtvfpkepvelgqpntlichidrffppvlnvt
    wlcngepvtegvaeslflprtdysfhkfhyltfvpsaedvydcrvehwgldqpllkhwea
    q
    

  • Chain 'H':
    No sequence available.