Lineage for d4tw9a_ (4tw9 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2218626Protein Casein kinase-1, CK1 [56139] (4 species)
    OPK group; CKI subfamily; serine/threonine kinase
  7. 2218632Species Human (Homo sapiens) [TaxId:9606] [224941] (14 PDB entries)
  8. 2218664Domain d4tw9a_: 4tw9 A: [258555]
    automated match to d1ckia_
    complexed with 386, cl, hsj, na, so4

Details for d4tw9a_

PDB Entry: 4tw9 (more details), 2.4 Å

PDB Description: difluoro-dioxolo-benzoimidazol-benzamides as potent inhibitors of ck1delta and epsilon with nanomolar inhibitory activity on cancer cell proliferation
PDB Compounds: (A:) Casein kinase I isoform delta

SCOPe Domain Sequences for d4tw9a_:

Sequence, based on SEQRES records: (download)

>d4tw9a_ d.144.1.7 (A:) Casein kinase-1, CK1 {Human (Homo sapiens) [TaxId: 9606]}
elrvgnryrlgnkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmqg
gvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihs
knfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryas
inthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlc
kgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlkf

Sequence, based on observed residues (ATOM records): (download)

>d4tw9a_ d.144.1.7 (A:) Casein kinase-1, CK1 {Human (Homo sapiens) [TaxId: 9606]}
elrvgnryrlgnkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmqg
gvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihs
knfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryas
inthlgieqsrrddleslgyvlmyfnlgslpwqglkaakyerisekkmstpievlckgyp
sefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlkf

SCOPe Domain Coordinates for d4tw9a_:

Click to download the PDB-style file with coordinates for d4tw9a_.
(The format of our PDB-style files is described here.)

Timeline for d4tw9a_: