Lineage for d4q74a2 (4q74 A:340-443)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2028025Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 2028028Species Human (Homo sapiens) [TaxId:9606] [88590] (67 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 2028074Domain d4q74a2: 4q74 A:340-443 [258329]
    Other proteins in same PDB: d4q74a1, d4q74b1
    automated match to d1hzhh4
    complexed with bma, fuc

Details for d4q74a2

PDB Entry: 4q74 (more details), 2.19 Å

PDB Description: f241a fc
PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d4q74a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q74a2 b.1.1.2 (A:340-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvld
sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl

SCOPe Domain Coordinates for d4q74a2:

Click to download the PDB-style file with coordinates for d4q74a2.
(The format of our PDB-style files is described here.)

Timeline for d4q74a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4q74a1