Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries) |
Domain d4pj9c2: 4pj9 C:111-198 [258223] Other proteins in same PDB: d4pj9a1, d4pj9a2, d4pj9a3, d4pj9b1, d4pj9b2, d4pj9c1, d4pj9d1, d4pj9d2 automated match to d2f54d2 complexed with 2lj, gol, na |
PDB Entry: 4pj9 (more details), 2 Å
SCOPe Domain Sequences for d4pj9c2:
Sequence, based on SEQRES records: (download)
>d4pj9c2 b.1.1.2 (C:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffp
>d4pj9c2 b.1.1.2 (C:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdsksksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsav awsacanafnnsiipedtffp
Timeline for d4pj9c2: