Lineage for d4pj7f1 (4pj7 F:3-113)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1765963Domain d4pj7f1: 4pj7 F:3-113 [258204]
    Other proteins in same PDB: d4pj7a1, d4pj7b_, d4pj7c1, d4pj7d_, d4pj7e2, d4pj7g2
    automated match to d3q5ya1
    complexed with 2lj

Details for d4pj7f1

PDB Entry: 4pj7 (more details), 2.5 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait trbv6-4 tcr
PDB Compounds: (F:) TCR-beta

SCOPe Domain Sequences for d4pj7f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pj7f1 b.1.1.0 (F:3-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gitqaptsqilaagrrmtlrctqdmrhnamywyrqdlglglrlihysntagttgkgevpd
gysvsrantddfpltlasavpsqtsvyfcassggtnneqffgpgtrltvle

SCOPe Domain Coordinates for d4pj7f1:

Click to download the PDB-style file with coordinates for d4pj7f1.
(The format of our PDB-style files is described here.)

Timeline for d4pj7f1: