Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (26 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries) |
Domain d4pj7h1: 4pj7 H:3-113 [258206] Other proteins in same PDB: d4pj7a1, d4pj7b_, d4pj7c1, d4pj7d_, d4pj7e2, d4pj7g2 automated match to d3q5ya1 complexed with 2lj |
PDB Entry: 4pj7 (more details), 2.5 Å
SCOPe Domain Sequences for d4pj7h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pj7h1 b.1.1.0 (H:3-113) automated matches {Human (Homo sapiens) [TaxId: 9606]} gitqaptsqilaagrrmtlrctqdmrhnamywyrqdlglglrlihysntagttgkgevpd gysvsrantddfpltlasavpsqtsvyfcassggtnneqffgpgtrltvle
Timeline for d4pj7h1: