Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
Protein automated matches [190514] (11 species) not a true protein |
Species Escherichia coli [TaxId:562] [187587] (3 PDB entries) |
Domain d4p66a_: 4p66 A: [258099] automated match to d3k74a_ complexed with ca, mtx, nap |
PDB Entry: 4p66 (more details), 1.84 Å
SCOPe Domain Sequences for d4p66a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p66a_ c.71.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]} misliaalavdrvigmenampwnlpadlawfkrntlnkpvimgrhxwesigrplpgrkni ilssqpgtddrvtwvksvdeaiaaagdvpeimvigggrvyeqflpkaqklylthidaeve gdthfpdyepddwesvfsefhdadaqnshsysfeilerr
Timeline for d4p66a_: