Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.244: Cell division protein ZapA-like [102828] (1 superfamily) core: beta(2)-alpha(2), 2 layers: alpha/beta; long C-terminal helix forms dimeric parallel and tetrameric antiparallel coiled coils |
Superfamily d.244.1: Cell division protein ZapA-like [102829] (2 families) automatically mapped to Pfam PF05164 |
Family d.244.1.0: automated matches [258066] (1 protein) not a true family |
Protein automated matches [258067] (1 species) not a true protein |
Species Escherichia coli [TaxId:562] [258069] (1 PDB entry) |
Domain d4p1mb_: 4p1m B: [258072] automated match to d1t3ub_ complexed with cl |
PDB Entry: 4p1m (more details), 1.95 Å
SCOPe Domain Sequences for d4p1mb_:
Sequence, based on SEQRES records: (download)
>d4p1mb_ d.244.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]} saqpvdiqifgrslrvncppdqrdalnqaaddlnqrlqdlkertrvtnteqlvfiaalni syelaqekaktrdyaasmeqrirmlqqtieqalleqgritektnqnfe
>d4p1mb_ d.244.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]} saqpvdiqifgrslrvncppdqrdalnqaaddlnqrlqdlkertvtnteqlvfiaalnis yelaqekaktrdyaasmeqrirmlqqtieqalleqgritektnqnfe
Timeline for d4p1mb_: