SCOPe 2.04: Domain d4p1mb_: 4p1m B:

Lineage for d4p1mb_ (4p1m B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.244: Cell division protein ZapA-like [102828] (1 superfamily)
   core: beta(2)-alpha(2), 2 layers: alpha/beta; long C-terminal helix forms dimeric parallel and tetrameric antiparallel coiled coils

4. Superfamily d.244.1: Cell division protein ZapA-like [102829] (2 families)
   automatically mapped to Pfam PF05164

5. Family d.244.1.0: automated matches [258066] (1 protein)
   not a true family

6. Protein automated matches [258067] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [258069] (1 PDB entry)

8. Domain d4p1mb_: 4p1m B: [258072]
   automated match to d1t3ub_
   complexed with cl

Details for d4p1mb_

PDB Entry: 4p1m, 1.95 Å

PDB Description: the structure of escherichia coli zapa

PDB Compounds: (B:) Cell division protein ZapA

SCOPe Domain Sequences for d4p1mb_:

Sequence, based on SEQRES records:

>d4p1mb_ d.244.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
saqpvdiqifgrslrvncppdqrdalnqaaddlnqrlqdlkertrvtnteqlvfiaalni
syelaqekaktrdyaasmeqrirmlqqtieqalleqgritektnqnfe

Sequence, based on observed residues (ATOM records):

>d4p1mb_ d.244.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
saqpvdiqifgrslrvncppdqrdalnqaaddlnqrlqdlkertvtnteqlvfiaalnis
yelaqekaktrdyaasmeqrirmlqqtieqalleqgritektnqnfe

Timeline for d4p1mb_:

• d4p1mb_ is new in SCOPe 2.04-stable
  
• d4p1mb_ appears in SCOPe 2.05
  
• d4p1mb_ appears in the current release, SCOPe 2.08