![]() | Class g: Small proteins [56992] (94 folds) |
![]() | Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
![]() | Superfamily g.14.1: Kringle-like [57440] (3 families) ![]() |
![]() | Family g.14.1.1: Kringle modules [57441] (7 proteins) |
![]() | Protein automated matches [226950] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225942] (11 PDB entries) |
![]() | Domain d4bvwa_: 4bvw A: [257718] automated match to d2feba_ complexed with cl, edo, hky |
PDB Entry: 4bvw (more details), 2 Å
SCOPe Domain Sequences for d4bvwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bvwa_ g.14.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dcyhgdgqsyrgsfsttvtgrtcqswssmtphwhqrtteyypnggltrnycrnpdaeirp wcytmdpsvrweycaltqc
Timeline for d4bvwa_: