SCOPe 2.07: Domain d4bvwa_: 4bvw A:

Lineage for d4bvwa_ (4bvw A:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (3 families)

5. Family g.14.1.1: Kringle modules [57441] (7 proteins)

6. Protein automated matches [226950] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225942] (12 PDB entries)

8. Domain d4bvwa_: 4bvw A: [257718]
   automated match to d2feba_
   complexed with cl, edo, hky

Details for d4bvwa_

PDB Entry: 4bvw, 2 Å

PDB Description: Identification of small molecule inhibitors selective for apo(a) kringles KIV-7, KIV-10 and KV.

PDB Compounds: (A:) apolipoprotein(a)

SCOPe Domain Sequences for d4bvwa_:

Sequence; same for both SEQRES and ATOM records:

>d4bvwa_ g.14.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dcyhgdgqsyrgsfsttvtgrtcqswssmtphwhqrtteyypnggltrnycrnpdaeirp
wcytmdpsvrweycaltqc

Timeline for d4bvwa_:

• d4bvwa_ first appeared in SCOPe 2.04
  
• d4bvwa_ appears in SCOPe 2.06
  
• d4bvwa_ appears in the current release, SCOPe 2.08