Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily) beta-alpha(3)-beta(2) motif |
Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1) |
Family d.150.1.1: 4'-Phosphopantetheinyl transferase SFP [56215] (2 proteins) monomeric; tandem duplication of beta-alpha(3)-beta(2) motif |
Protein automated matches [257101] (1 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [257102] (1 PDB entry) |
Domain d4mrta2: 4mrt A:102-224 [257104] Other proteins in same PDB: d4mrta3, d4mrtc1, d4mrtc2 automated match to d1qr0a2 complexed with coa, gol, mg, so4 |
PDB Entry: 4mrt (more details), 2 Å
SCOPe Domain Sequences for d4mrta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mrta2 d.150.1.1 (A:102-224) automated matches {Bacillus subtilis [TaxId: 224308]} qpigidiektkpisleiakrffskteysdllakdkdeqtdyfyhlwsmkesfikqegkgl slpldsfsvrlhqdgqvsielpdshspcyiktyevdpgykmavcaahpdfpeditmvsye ell
Timeline for d4mrta2: