SCOPe 2.08: Domain d4mrta1: 4mrt A:1-101

Lineage for d4mrta1 (4mrt A:1-101)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
   beta-alpha(3)-beta(2) motif

4. Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families)
   possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)

5. Family d.150.1.1: 4'-Phosphopantetheinyl transferase SFP [56215] (2 proteins)
   monomeric; tandem duplication of beta-alpha(3)-beta(2) motif

6. Protein automated matches [257101] (1 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [257102] (1 PDB entry)

8. Domain d4mrta1: 4mrt A:1-101 [257103]
   Other proteins in same PDB: d4mrta3, d4mrtc1, d4mrtc2
   automated match to d1qr0a1
   complexed with coa, gol, mg, so4

Details for d4mrta1

PDB Entry: 4mrt, 2 Å

PDB Description: Structure of the Phosphopantetheine Transferase Sfp in Complex with Coenzyme A and a Peptidyl Carrier Protein

PDB Compounds: (A:) 4'-phosphopantetheinyl transferase sfp

SCOPe Domain Sequences for d4mrta1:

Sequence; same for both SEQRES and ATOM records:

>d4mrta1 d.150.1.1 (A:1-101) automated matches {Bacillus subtilis [TaxId: 224308]}
mkiygiymdrplsqeenerfmtfispekrekcrrfyhkedahrtllgdvlvrsvisrqyq
ldksdirfstqeygkpcipdlpdahfnishsgrwvigafds

Timeline for d4mrta1:

• d4mrta1 first appeared in SCOPe 2.04
  
• d4mrta1 appears in SCOPe 2.07