Class b: All beta proteins [48724] (180 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins) coupled with a NADP-binding domain of alpha/beta class |
Protein Nitrate reductase core domain [50425] (1 species) |
Species Maize (Zea mays) [TaxId:4577] [50426] (3 PDB entries) |
Domain d1cnfa1: 1cnf A:11-124 [25660] Other proteins in same PDB: d1cnfa2 complexed with adp, fad; mutant |
PDB Entry: 1cnf (more details), 2.7 Å
SCOPe Domain Sequences for d1cnfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cnfa1 b.43.4.2 (A:11-124) Nitrate reductase core domain {Maize (Zea mays) [TaxId: 4577]} grihcrlvakkelsrdvrlfrfslpspdqvlglpigkhifvcatiegklcmraytptsmv deighfdllvkvyfknehpkfpngglmtqyldslpvgsyidvkgplghveytgr
Timeline for d1cnfa1: