Lineage for d2aaib2 (2aai B:136-262)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 951553Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 951778Superfamily b.42.2: Ricin B-like lectins [50370] (3 families) (S)
  5. 951779Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 951838Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
    duplication: consists of two domains of this fold
  7. 951842Species Castor bean (Ricinus communis), Ricin [TaxId:3988] [50373] (2 PDB entries)
    Uniprot P06750 303-564
  8. 951844Domain d2aaib2: 2aai B:136-262 [25562]
    Other proteins in same PDB: d2aaia_

Details for d2aaib2

PDB Entry: 2aai (more details), 2.5 Å

PDB Description: crystallographic refinement of ricin to 2.5 angstroms
PDB Compounds: (B:) ricin (b chain)

SCOPe Domain Sequences for d2aaib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aaib2 b.42.2.1 (B:136-262) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]}
ntqpfvttivglyglclqansgqvwiedcssekaeqqwalyadgsirpqqnrdncltsds
niretvvkilscgpassgqrwmfkndgtilnlysglvldvrasdpslkqiilyplhgdpn
qiwlplf

SCOPe Domain Coordinates for d2aaib2:

Click to download the PDB-style file with coordinates for d2aaib2.
(The format of our PDB-style files is described here.)

Timeline for d2aaib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2aaib1
View in 3D
Domains from other chains:
(mouse over for more information)
d2aaia_