Class b: All beta proteins [48724] (174 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (3 families) |
Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
Protein Plant cytotoxin B-chain (lectin) [50372] (5 species) duplication: consists of two domains of this fold |
Species Castor bean (Ricinus communis), Ricin [TaxId:3988] [50373] (2 PDB entries) Uniprot P06750 303-564 |
Domain d2aaib1: 2aai B:1-135 [25561] Other proteins in same PDB: d2aaia_ |
PDB Entry: 2aai (more details), 2.5 Å
SCOPe Domain Sequences for d2aaib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aaib1 b.42.2.1 (B:1-135) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} advcmdpepivrivgrnglcvdvrdgrfhngnaiqlwpcksntdanqlwtlkrdntirsn gkclttygyspgvyvmiydcntaatdatrwqiwdngtiinprsslvlaatsgnsgttltv qtniyavsqgwlptn
Timeline for d2aaib1: