Lineage for d4no6f_ (4no6 F:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2554828Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2554829Protein automated matches [190509] (16 species)
    not a true protein
  7. 2554883Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (108 PDB entries)
  8. 2555011Domain d4no6f_: 4no6 F: [253990]
    Other proteins in same PDB: d4no6a_, d4no6b_, d4no6e_, d4no6g_, d4no6h_, d4no6i_, d4no6j_, d4no6k_, d4no6l_, d4no6m_, d4no6n_, d4no6o_, d4no6p_, d4no6s_, d4no6u_, d4no6v_, d4no6w_, d4no6x_, d4no6y_, d4no6z_
    automated match to d1irug_
    complexed with 2m1, mg

Details for d4no6f_

PDB Entry: 4no6 (more details), 3 Å

PDB Description: yCP in complex with Z-Leu-Leu-Leu-vinylsulfone
PDB Compounds: (F:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d4no6f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4no6f_ d.153.1.0 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d4no6f_:

Click to download the PDB-style file with coordinates for d4no6f_.
(The format of our PDB-style files is described here.)

Timeline for d4no6f_: