Lineage for d4no6c1 (4no6 C:1-234)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995888Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2995889Protein automated matches [190509] (19 species)
    not a true protein
  7. 2995948Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)
  8. 2996076Domain d4no6c1: 4no6 C:1-234 [253988]
    Other proteins in same PDB: d4no6a_, d4no6b_, d4no6c2, d4no6e_, d4no6g_, d4no6h_, d4no6i_, d4no6j_, d4no6k_, d4no6l_, d4no6m_, d4no6n_, d4no6o_, d4no6p_, d4no6q2, d4no6s_, d4no6u_, d4no6v_, d4no6w_, d4no6x_, d4no6y_, d4no6z_
    automated match to d4eu2a_
    complexed with 2m1, mg

Details for d4no6c1

PDB Entry: 4no6 (more details), 3 Å

PDB Description: yCP in complex with Z-Leu-Leu-Leu-vinylsulfone
PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4no6c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4no6c1 d.153.1.0 (C:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

SCOPe Domain Coordinates for d4no6c1:

Click to download the PDB-style file with coordinates for d4no6c1.
(The format of our PDB-style files is described here.)

Timeline for d4no6c1: