Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries) |
Domain d4no6c1: 4no6 C:1-234 [253988] Other proteins in same PDB: d4no6a_, d4no6b_, d4no6c2, d4no6e_, d4no6g_, d4no6h_, d4no6i_, d4no6j_, d4no6k_, d4no6l_, d4no6m_, d4no6n_, d4no6o_, d4no6p_, d4no6q2, d4no6s_, d4no6u_, d4no6v_, d4no6w_, d4no6x_, d4no6y_, d4no6z_ automated match to d4eu2a_ complexed with 2m1, mg |
PDB Entry: 4no6 (more details), 3 Å
SCOPe Domain Sequences for d4no6c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4no6c1 d.153.1.0 (C:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi
Timeline for d4no6c1: