Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.218: Nucleotidyltransferase [81302] (1 superfamily) core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123 |
Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) |
Family d.218.1.0: automated matches [227287] (1 protein) not a true family |
Protein automated matches [227105] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226559] (18 PDB entries) |
Domain d4lt6b1: 4lt6 B:18-213 [253689] Other proteins in same PDB: d4lt6a2, d4lt6a3, d4lt6b2, d4lt6b3 automated match to d1f5aa4 complexed with 3at, ca |
PDB Entry: 4lt6 (more details), 2.79 Å
SCOPe Domain Sequences for d4lt6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lt6b1 d.218.1.0 (B:18-213) automated matches {Human (Homo sapiens) [TaxId: 9606]} hygitspislaspkeidhiytqklidamkpfgvfedeeelnhrlvvlgklnnlvkewisd vsesknlppsvvatvggkiftfgsyrlgvhtkgadidalcvaprhversdffqsffeklk hqdgirnlravedafvpvikfefdgieidlvfarlaiqtisdnldlrddsrlrsldirci rslngcrvtdeilhlv
Timeline for d4lt6b1: