Lineage for d4lt6b1 (4lt6 B:18-213)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006866Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 3006867Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 3007364Family d.218.1.0: automated matches [227287] (1 protein)
    not a true family
  6. 3007365Protein automated matches [227105] (6 species)
    not a true protein
  7. 3007371Species Human (Homo sapiens) [TaxId:9606] [226559] (18 PDB entries)
  8. 3007388Domain d4lt6b1: 4lt6 B:18-213 [253689]
    Other proteins in same PDB: d4lt6a2, d4lt6a3, d4lt6b2, d4lt6b3
    automated match to d1f5aa4
    complexed with 3at, ca

Details for d4lt6b1

PDB Entry: 4lt6 (more details), 2.79 Å

PDB Description: Crystal Structure of human poly(A) polymerase gamma
PDB Compounds: (B:) Poly(A) polymerase gamma

SCOPe Domain Sequences for d4lt6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lt6b1 d.218.1.0 (B:18-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hygitspislaspkeidhiytqklidamkpfgvfedeeelnhrlvvlgklnnlvkewisd
vsesknlppsvvatvggkiftfgsyrlgvhtkgadidalcvaprhversdffqsffeklk
hqdgirnlravedafvpvikfefdgieidlvfarlaiqtisdnldlrddsrlrsldirci
rslngcrvtdeilhlv

SCOPe Domain Coordinates for d4lt6b1:

Click to download the PDB-style file with coordinates for d4lt6b1.
(The format of our PDB-style files is described here.)

Timeline for d4lt6b1: