SCOPe 2.08: Domain d4lt6a1: 4lt6 A:17-213

Lineage for d4lt6a1 (4lt6 A:17-213)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
   core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123

4. Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families)

5. Family d.218.1.0: automated matches [227287] (1 protein)
   not a true family

6. Protein automated matches [227105] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226559] (18 PDB entries)

8. Domain d4lt6a1: 4lt6 A:17-213 [253686]
   Other proteins in same PDB: d4lt6a2, d4lt6a3, d4lt6b2, d4lt6b3
   automated match to d1f5aa4
   complexed with 3at, ca

Details for d4lt6a1

PDB Entry: 4lt6, 2.79 Å

PDB Description: Crystal Structure of human poly(A) polymerase gamma

PDB Compounds: (A:) Poly(A) polymerase gamma

SCOPe Domain Sequences for d4lt6a1:

Sequence; same for both SEQRES and ATOM records:

>d4lt6a1 d.218.1.0 (A:17-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
khygitspislaspkeidhiytqklidamkpfgvfedeeelnhrlvvlgklnnlvkewis
dvsesknlppsvvatvggkiftfgsyrlgvhtkgadidalcvaprhversdffqsffekl
khqdgirnlravedafvpvikfefdgieidlvfarlaiqtisdnldlrddsrlrsldirc
irslngcrvtdeilhlv

Timeline for d4lt6a1:

• d4lt6a1 first appeared in SCOPe 2.04
  
• d4lt6a1 appears in SCOPe 2.07