SCOPe 2.08: Domain d4kk2a_: 4kk2 A:

Lineage for d4kk2a_ (4kk2 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.0: automated matches [196408] (1 protein)
   not a true family

6. Protein automated matches [196409] (46 species)
   not a true protein

7. Species Artemisia spiciformis [TaxId:235357] [256342] (1 PDB entry)

8. Domain d4kk2a_: 4kk2 A: [253274]
   automated match to d4jzxa_

Details for d4kk2a_

PDB Entry: 4kk2, 2.2 Å

PDB Description: crystal structure of a chimeric fpp/gfpp synthase (target efi-502313c) from artemisia spiciformis (1-72:gi751454468,73-346:gi75233326), apo structure

PDB Compounds: (A:) Monoterpene synthase FDS-5, chloroplastic - Farnesyl diphosphate synthase 1 chimera

SCOPe Domain Sequences for d4kk2a_:

Sequence; same for both SEQRES and ATOM records:

>d4kk2a_ a.128.1.0 (A:) automated matches {Artemisia spiciformis [TaxId: 235357]}
lnsqfmqvyetlkselihdplfefdddsrqwvermidytvpggkmvrgysvvdsyqllkg
eeltddeiflssalgwciewlqayflvlddimdeshtrrgqpcwfrlpkvgmiaandgil
lrnhvprilkkhfrgkpyyvdlvdlfnevefqtasgqmidlittlvgekdlskyslsihr
rivqyktayysfylpvacallmfgedldkhvevknvlvemgtyfqvqddyldcfgapevi
gkigtdiedfkcswlvvkalelaneeqkktlhenygkkdpasvakvkevyhtlnlqavfe
dyeatsykklitsienhpskavqavlksflgkiykrqk

Timeline for d4kk2a_:

• d4kk2a_ first appeared in SCOPe 2.04
  
• d4kk2a_ appears in SCOPe 2.07