Lineage for d4kk2a_ (4kk2 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2344488Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2344489Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2344939Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2344940Protein automated matches [196409] (45 species)
    not a true protein
  7. 2344944Species Artemisia spiciformis [TaxId:235357] [256342] (1 PDB entry)
  8. 2344945Domain d4kk2a_: 4kk2 A: [253274]
    automated match to d4jzxa_

Details for d4kk2a_

PDB Entry: 4kk2 (more details), 2.2 Å

PDB Description: crystal structure of a chimeric fpp/gfpp synthase (target efi-502313c) from artemisia spiciformis (1-72:gi751454468,73-346:gi75233326), apo structure
PDB Compounds: (A:) Monoterpene synthase FDS-5, chloroplastic - Farnesyl diphosphate synthase 1 chimera

SCOPe Domain Sequences for d4kk2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kk2a_ a.128.1.0 (A:) automated matches {Artemisia spiciformis [TaxId: 235357]}
lnsqfmqvyetlkselihdplfefdddsrqwvermidytvpggkmvrgysvvdsyqllkg
eeltddeiflssalgwciewlqayflvlddimdeshtrrgqpcwfrlpkvgmiaandgil
lrnhvprilkkhfrgkpyyvdlvdlfnevefqtasgqmidlittlvgekdlskyslsihr
rivqyktayysfylpvacallmfgedldkhvevknvlvemgtyfqvqddyldcfgapevi
gkigtdiedfkcswlvvkalelaneeqkktlhenygkkdpasvakvkevyhtlnlqavfe
dyeatsykklitsienhpskavqavlksflgkiykrqk

SCOPe Domain Coordinates for d4kk2a_:

Click to download the PDB-style file with coordinates for d4kk2a_.
(The format of our PDB-style files is described here.)

Timeline for d4kk2a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4kk2b_