Class a: All alpha proteins [46456] (289 folds) |
Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
Superfamily a.128.1: Terpenoid synthases [48576] (6 families) duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
Family a.128.1.0: automated matches [196408] (1 protein) not a true family |
Protein automated matches [196409] (45 species) not a true protein |
Species Artemisia spiciformis [TaxId:235357] [256342] (1 PDB entry) |
Domain d4kk2a_: 4kk2 A: [253274] automated match to d4jzxa_ |
PDB Entry: 4kk2 (more details), 2.2 Å
SCOPe Domain Sequences for d4kk2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kk2a_ a.128.1.0 (A:) automated matches {Artemisia spiciformis [TaxId: 235357]} lnsqfmqvyetlkselihdplfefdddsrqwvermidytvpggkmvrgysvvdsyqllkg eeltddeiflssalgwciewlqayflvlddimdeshtrrgqpcwfrlpkvgmiaandgil lrnhvprilkkhfrgkpyyvdlvdlfnevefqtasgqmidlittlvgekdlskyslsihr rivqyktayysfylpvacallmfgedldkhvevknvlvemgtyfqvqddyldcfgapevi gkigtdiedfkcswlvvkalelaneeqkktlhenygkkdpasvakvkevyhtlnlqavfe dyeatsykklitsienhpskavqavlksflgkiykrqk
Timeline for d4kk2a_: