SCOPe 2.06: Domain d4jk4b2: 4jk4 B:196-387

Lineage for d4jk4b2 (4jk4 B:196-387)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.0: automated matches [254216] (1 protein)
   not a true family

6. Protein automated matches [254493] (6 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [256128] (4 PDB entries)

8. Domain d4jk4b2: 4jk4 B:196-387 [252964]
   automated match to d4l8ua2
   complexed with 1pe, ca, diu, peg, pge

Details for d4jk4b2

PDB Entry: 4jk4, 2.65 Å

PDB Description: crystal structure of bovine serum albumin in complex with 3,5- diiodosalicylic acid

PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d4jk4b2:

Sequence; same for both SEQRES and ATOM records:

>d4jk4b2 a.126.1.0 (B:196-387) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rlrcasiqkfgeralkawsvarlsqkfpkaefvevtklvtdltkvhkecchgdllecadd
radlakyicdnqdtissklkeccdkpllekshciaevekdaipenlppltadfaedkdvc
knyqeakdaflgsflyeysrrhpeyavsvllrlakeyeatleeccakddphacystvfdk
lkhlvdepqnli

Timeline for d4jk4b2:

• d4jk4b2 first appeared in SCOPe 2.04
  
• d4jk4b2 appears in SCOPe 2.05
  
• d4jk4b2 appears in SCOPe 2.07
  
• d4jk4b2 appears in the current release, SCOPe 2.08