Class a: All alpha proteins [46456] (289 folds) |
Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (2 families) |
Family a.126.1.0: automated matches [254216] (1 protein) not a true family |
Protein automated matches [254493] (6 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [256128] (4 PDB entries) |
Domain d4jk4a1: 4jk4 A:2-195 [252960] automated match to d3jrya1 complexed with 1pe, ca, diu, peg, pge |
PDB Entry: 4jk4 (more details), 2.65 Å
SCOPe Domain Sequences for d4jk4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jk4a1 a.126.1.0 (A:2-195) automated matches {Cow (Bos taurus) [TaxId: 9913]} thkseiahrfkdlgeehfkglvliafsqylqqcpfdehvklvneltefaktcvadeshag cekslhtlfgdelckvaslretygdmadccekqepernecflshkddspdlpklkpdpnt lcdefkadekkfwgkylyeiarrhpyfyapellyyankyngvfqeccqaedkgacllpki etmrekvltssarq
Timeline for d4jk4a1: