Lineage for d1bvsg3 (1bvs G:1-63)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 166216Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 166762Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families) (S)
  5. 166802Family b.40.4.2: DNA helicase RuvA subunit, N-terminal domain [50259] (1 protein)
  6. 166803Protein DNA helicase RuvA subunit, N-terminal domain [50260] (2 species)
  7. 166814Species Mycobacterium leprae [TaxId:1769] [50262] (1 PDB entry)
  8. 166821Domain d1bvsg3: 1bvs G:1-63 [25280]
    Other proteins in same PDB: d1bvsa1, d1bvsa2, d1bvsb1, d1bvsb2, d1bvsc1, d1bvsc2, d1bvsd1, d1bvsd2, d1bvse1, d1bvse2, d1bvsf1, d1bvsf2, d1bvsg1, d1bvsg2, d1bvsh1, d1bvsh2

Details for d1bvsg3

PDB Entry: 1bvs (more details), 3 Å

PDB Description: ruva complexed to a holliday junction.

SCOP Domain Sequences for d1bvsg3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvsg3 b.40.4.2 (G:1-63) DNA helicase RuvA subunit, N-terminal domain {Mycobacterium leprae}
mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
gfs

SCOP Domain Coordinates for d1bvsg3:

Click to download the PDB-style file with coordinates for d1bvsg3.
(The format of our PDB-style files is described here.)

Timeline for d1bvsg3: