SCOP 1.61: Domain d1bvsh2: 1bvs H:64-133

Lineage for d1bvsh2 (1bvs H:64-133)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.60: SAM domain-like [47768] (11 superfamilies)

4. Superfamily a.60.2: RuvA domain 2-like [47781] (2 families)

5. Family a.60.2.1: DNA helicase RuvA subunit, middle domain [47782] (1 protein)

6. Protein DNA helicase RuvA subunit, middle domain [47783] (2 species)

7. Species Mycobacterium leprae [TaxId:1769] [47785] (1 PDB entry)

8. Domain d1bvsh2: 1bvs H:64-133 [17962]
   Other proteins in same PDB: d1bvsa1, d1bvsa3, d1bvsb1, d1bvsb3, d1bvsc1, d1bvsc3, d1bvsd1, d1bvsd3, d1bvse1, d1bvse3, d1bvsf1, d1bvsf3, d1bvsg1, d1bvsg3, d1bvsh1, d1bvsh3

Details for d1bvsh2

PDB Entry: 1bvs, 3 Å

PDB Description: ruva complexed to a holliday junction.

SCOP Domain Sequences for d1bvsh2:

Sequence; same for both SEQRES and ATOM records:

>d1bvsh2 a.60.2.1 (H:64-133) DNA helicase RuvA subunit, middle domain {Mycobacterium leprae}
daenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrgaeri
vleladkvgp

Timeline for d1bvsh2:

• d1bvsh2 first appeared (with stable ids) in SCOP 1.55
  
• d1bvsh2 appears in SCOP 1.59
  
• d1bvsh2 appears in SCOP 1.63
  
• d1bvsh2 appears in the current release, SCOPe 2.08