Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.116: alpha/beta knot [75216] (1 superfamily) core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot |
Superfamily c.116.1: alpha/beta knot [75217] (9 families) known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily all known members have dimeric structures |
Family c.116.1.0: automated matches [191557] (1 protein) not a true family |
Protein automated matches [190961] (13 species) not a true protein |
Species Anaplasma phagocytophilum [TaxId:212042] [232723] (2 PDB entries) |
Domain d4ig6a_: 4ig6 A: [252618] automated match to d3knub_ protein/RNA complex; complexed with cl, sah |
PDB Entry: 4ig6 (more details), 2.4 Å
SCOPe Domain Sequences for d4ig6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ig6a_ c.116.1.0 (A:) automated matches {Anaplasma phagocytophilum [TaxId: 212042]} smifnvltifpqmfpgplgvsnlgsalkkglwtlnvfdirafannkhntvddtpygggpg mllradvlgrcidevlslhpntklmftsprgvsftqdiarqtmnfdnitllcgrfegide rvvdfyklqevsigdyvlsggelaamviidtcvrmvpgvignaeslkqesmegsleypqy trpaswkgmevpevlltgnhgeiekwrrnaslsitaarrpdll
Timeline for d4ig6a_: