Lineage for d4i2fa2 (4i2f A:243-302)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737577Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1738431Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1738680Family a.60.12.0: automated matches [254215] (1 protein)
    not a true family
  6. 1738681Protein automated matches [254483] (3 species)
    not a true protein
  7. 1738688Species Mouse (Mus musculus) [TaxId:10090] [255237] (29 PDB entries)
  8. 1738692Domain d4i2fa2: 4i2f A:243-302 [252571]
    Other proteins in same PDB: d4i2fa1, d4i2fa3
    automated match to d1jmsa3
    protein/DNA complex; complexed with mg, na, zn

Details for d4i2fa2

PDB Entry: 4i2f (more details), 2.1 Å

PDB Description: binary complex of mouse tdt with ssdna
PDB Compounds: (A:) DNA nucleotidylexotransferase

SCOPe Domain Sequences for d4i2fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i2fa2 a.60.12.0 (A:243-302) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
deryksfklftsvfgvglktaekwfrmgfrtlskiqsdkslrftqmqkagflyyedlvsc

SCOPe Domain Coordinates for d4i2fa2:

Click to download the PDB-style file with coordinates for d4i2fa2.
(The format of our PDB-style files is described here.)

Timeline for d4i2fa2: