SCOPe 2.06: Domain d4h3zb1: 4h3z B:1-254

Lineage for d4h3zb1 (4h3z B:1-254)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
   core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot

4. Superfamily c.116.1: alpha/beta knot [75217] (9 families)
   known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
   all known members have dimeric structures

5. Family c.116.1.0: automated matches [191557] (1 protein)
   not a true family

6. Protein automated matches [190961] (16 species)
   not a true protein

7. Species Burkholderia phymatum [TaxId:391038] [256282] (2 PDB entries)

8. Domain d4h3zb1: 4h3z B:1-254 [252377]
   Other proteins in same PDB: d4h3za2, d4h3zb2
   automated match to d1uala_
   complexed with cl, sah

Details for d4h3zb1

PDB Entry: 4h3z, 2.15 Å

PDB Description: Crystal structure of a symmetric dimer of a tRNA (guanine-(N(1)-)-methyltransferase from Burkholderia phymatum bound to S-adenosyl homocystein in both half-sites

PDB Compounds: (B:) tRNA (guanine-N(1)-)-methyltransferase

SCOPe Domain Sequences for d4h3zb1:

Sequence; same for both SEQRES and ATOM records:

>d4h3zb1 c.116.1.0 (B:1-254) automated matches {Burkholderia phymatum [TaxId: 391038]}
mqfdivtlfpdmfraltdwgitsraakqeryglrtwnprdfttdnyrtiddrpygggpgm
vmlarpledainaakaaqaeqgiggarvvmmspqgatlnhdkvmrfaaepglillcgrye
aidqrlidrvvdeevslgdfvlsggelpamalidavvrhlpgvlndaqsavqdsfvdgll
dcphytrpeeydgvrvpdvllgghhaeieqwrrrealrntwlkrpdlivqarknkllsra
deawlaslakdask

Timeline for d4h3zb1:

• d4h3zb1 first appeared in SCOPe 2.04, called d4h3zb_
  
• d4h3zb1 was called d4h3zb_ in SCOPe 2.05
  
• d4h3zb1 appears in SCOPe 2.07
  
• d4h3zb1 appears in the current release, SCOPe 2.08