SCOP 1.65: Domain d1eu4a1: 1eu4 A:1-95

Lineage for d1eu4a1 (1eu4 A:1-95)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.40: OB-fold [50198] (9 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)

6. Protein Streptococcal superantigen Spe-H [50234] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [50235] (2 PDB entries)

8. Domain d1eu4a1: 1eu4 A:1-95 [25205]
   Other proteins in same PDB: d1eu4a2
   complexed with zn

Details for d1eu4a1

PDB Entry: 1eu4, 2.5 Å

PDB Description: crystal structure of the superantigen spe-h (zinc bound) from streptococcus pyogenes

SCOP Domain Sequences for d1eu4a1:

Sequence; same for both SEQRES and ATOM records:

>d1eu4a1 b.40.2.2 (A:1-95) Streptococcal superantigen Spe-H {Streptococcus pyogenes}
nsynttnrhnleslykhdsnlieadsiknspdivtshmlkysvkdknlsvffekdwisqe
fkdkevdiyalsaqevcecpgkryeafggitltns

Timeline for d1eu4a1:

• d1eu4a1 first appeared (with stable ids) in SCOP 1.55
  
• d1eu4a1 appears in SCOP 1.63
  
• d1eu4a1 appears in SCOP 1.67
  
• d1eu4a1 appears in the current release, SCOPe 2.08