PDB entry 1eu4

View 1eu4 on RCSB PDB site
Description: crystal structure of the superantigen spe-h (zinc bound) from streptococcus pyogenes
Deposited on 2000-04-13, released 2000-04-26
The last revision prior to the SCOP 1.65 freeze date was dated 2000-05-24, with a file datestamp of 2000-05-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.205
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eu4A (A:)
    nsynttnrhnleslykhdsnlieadsiknspdivtshmlkysvkdknlsvffekdwisqe
    fkdkevdiyalsaqevcecpgkryeafggitltnsekkeikvpvnvwdkskqqppmfitv
    nkpkvtaqevdikvrkllikkydiynnreqkyskgtvtldlnsgkdivfdlyyfgngdfn
    smlkiysnneridstqfhvdvsis