Lineage for d1eu4a1 (1eu4 A:1-95)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 13632Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 13929Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins)
  6. 14001Protein Streptococcal superantigen Spe-H [50234] (1 species)
  7. 14002Species Streptococcus pyogenes [TaxId:1314] [50235] (2 PDB entries)
  8. 14004Domain d1eu4a1: 1eu4 A:1-95 [25205]
    Other proteins in same PDB: d1eu4a2

Details for d1eu4a1

PDB Entry: 1eu4 (more details), 2.5 Å

PDB Description: crystal structure of the superantigen spe-h (zinc bound) from streptococcus pyogenes

SCOP Domain Sequences for d1eu4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eu4a1 b.40.2.2 (A:1-95) Streptococcal superantigen Spe-H {Streptococcus pyogenes}
nsynttnrhnleslykhdsnlieadsiknspdivtshmlkysvkdknlsvffekdwisqe
fkdkevdiyalsaqevcecpgkryeafggitltns

SCOP Domain Coordinates for d1eu4a1:

Click to download the PDB-style file with coordinates for d1eu4a1.
(The format of our PDB-style files is described here.)

Timeline for d1eu4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eu4a2