![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.40: OB-fold [50198] (9 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) ![]() |
![]() | Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins) |
![]() | Protein Staphylococcal enterotoxin H, SEH [50230] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [50231] (4 PDB entries) |
![]() | Domain d1ewca1: 1ewc A:2-101 [25199] Other proteins in same PDB: d1ewca2 complexed with zn |
PDB Entry: 1ewc (more details), 1.95 Å
SCOP Domain Sequences for d1ewca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ewca1 b.40.2.2 (A:2-101) Staphylococcal enterotoxin H, SEH {Staphylococcus aureus} dlhdkseltdlalanaygqynhpfikeniksdeisgekdlifrnqgdsgndlrvkfatad laqkfknknvdiygasfyykcekiseniseclyggttlns
Timeline for d1ewca1: