Lineage for d1ewca1 (1ewc A:2-101)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228551Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 228613Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 228945Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)
  6. 228990Protein Staphylococcal enterotoxin H, SEH [50230] (1 species)
  7. 228991Species Staphylococcus aureus [TaxId:1280] [50231] (4 PDB entries)
  8. 228993Domain d1ewca1: 1ewc A:2-101 [25199]
    Other proteins in same PDB: d1ewca2
    complexed with zn

Details for d1ewca1

PDB Entry: 1ewc (more details), 1.95 Å

PDB Description: crystal structure of zn2+ loaded staphylococcal enterotoxin h

SCOP Domain Sequences for d1ewca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewca1 b.40.2.2 (A:2-101) Staphylococcal enterotoxin H, SEH {Staphylococcus aureus}
dlhdkseltdlalanaygqynhpfikeniksdeisgekdlifrnqgdsgndlrvkfatad
laqkfknknvdiygasfyykcekiseniseclyggttlns

SCOP Domain Coordinates for d1ewca1:

Click to download the PDB-style file with coordinates for d1ewca1.
(The format of our PDB-style files is described here.)

Timeline for d1ewca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ewca2