![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) ![]() |
![]() | Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins) |
![]() | Protein Staphylococcal enterotoxin H, SEH [54346] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [54347] (4 PDB entries) |
![]() | Domain d1ewca2: 1ewc A:102-215 [37788] Other proteins in same PDB: d1ewca1 complexed with zn |
PDB Entry: 1ewc (more details), 1.95 Å
SCOP Domain Sequences for d1ewca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ewca2 d.15.6.1 (A:102-215) Staphylococcal enterotoxin H, SEH {Staphylococcus aureus} eklaqerviganvwvdgiqketelirtnkknvtlqeldikirkilsdkykiyykdseisk gliefdmktprdysfdiydlggendyeidkiyednktlksddishidvnlytkk
Timeline for d1ewca2: