Class b: All beta proteins [48724] (176 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
Protein automated matches [226849] (4 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255791] (18 PDB entries) |
Domain d4duvb5: 4duv B:731-1023 [251575] Other proteins in same PDB: d4duva1, d4duva2, d4duva3, d4duva4, d4duvb1, d4duvb2, d4duvb3, d4duvb4, d4duvc1, d4duvc2, d4duvc3, d4duvc4, d4duvd1, d4duvd2, d4duvd3, d4duvd4 automated match to d1jz8a4 complexed with 2dg, btb, dms, mg, na |
PDB Entry: 4duv (more details), 2.1 Å
SCOPe Domain Sequences for d4duvb5:
Sequence; same for both SEQRES and ATOM records: (download)
>d4duvb5 b.30.5.0 (B:731-1023) automated matches {Escherichia coli K-12 [TaxId: 83333]} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndiavseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d4duvb5:
View in 3D Domains from same chain: (mouse over for more information) d4duvb1, d4duvb2, d4duvb3, d4duvb4 |