PDB entry 4duv

View 4duv on RCSB PDB site
Description: E. coli (lacZ) beta-galactosidase (G974A) 2-deoxy-galactosyl-enzyme and bis-Tris complex
Class: hydrolase
Keywords: bi-functional enzyme, allolactose synthesis, TIM BARREL (ALPHA/BETA BARREL), JELLY-ROLL BARREL, IMMUNOGLOBULIN, BETA SUPERSANDWICH, BETA-GALACTOSIDASE, GLYCOSIDASE, HYDROLASE
Deposited on 2012-02-22, released 2013-04-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-04-03, with a file datestamp of 2013-03-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.159
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-galactosidase
    Species: Escherichia coli [TaxId:83333]
    Gene: b0344, JW0335, lacZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00722 (37-1051)
      • expression tag (33-36)
      • engineered mutation (822)
    Domains in SCOPe 2.04: d4duva1, d4duva2, d4duva3, d4duva4, d4duva5
  • Chain 'B':
    Compound: beta-galactosidase
    Species: Escherichia coli [TaxId:83333]
    Gene: b0344, JW0335, lacZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00722 (37-1051)
      • expression tag (34-36)
      • engineered mutation (822)
    Domains in SCOPe 2.04: d4duvb1, d4duvb2, d4duvb3, d4duvb4, d4duvb5
  • Chain 'C':
    Compound: beta-galactosidase
    Species: Escherichia coli [TaxId:83333]
    Gene: b0344, JW0335, lacZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00722 (37-1051)
      • expression tag (34-36)
      • engineered mutation (822)
    Domains in SCOPe 2.04: d4duvc1, d4duvc2, d4duvc3, d4duvc4, d4duvc5
  • Chain 'D':
    Compound: beta-galactosidase
    Species: Escherichia coli [TaxId:83333]
    Gene: b0344, JW0335, lacZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00722 (37-1051)
      • expression tag (34-36)
      • engineered mutation (822)
    Domains in SCOPe 2.04: d4duvd1, d4duvd2, d4duvd3, d4duvd4, d4duvd5
  • Heterogens: 2DG, BTB, MG, NA, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4duvA (A:)
    mggshhhhhhgmasmtggqqmgrdlyddddkdpmidpvvlqrrdwenpgvtqlnrlaahp
    pfaswrnseeartdrpsqqlrslngewrfawfpapeavpeswlecdlpeadtvvvpsnwq
    mhgydapiytnvtypitvnppfvptenptgcysltfnvdeswlqegqtriifdgvnsafh
    lwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrwsdgsyledqdmwrmsgifrd
    vsllhkpttqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgt
    apfggeiiderggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvg
    frevriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcsh
    ypnhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhp
    sviiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqp
    fpavpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwv
    dqslikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqqffqfrl
    sgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpelpqpesa
    gqlwltvrvvqpnatawseaghisawqqwrlaenlsvtlpaashaiphlttsemdfciel
    gnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapldndiavseatridpnawverwk
    aaghyqaeaallqctadtladavlittahawqhqgktlfisrktyridgsgqmaitvdve
    vasdtphpariglncqlaqvaervnwlglgpqenypdrltaacfdrwdlplsdmytpyvf
    psenglrcgtrelnygphqwrgdfqfnisrysqqqlmetshrhllhaeegtwlnidgfhm
    giggddswspsvsaefqlsagryhyqlvwcqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4duvA (A:)
    midpvvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfp
    apeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcys
    ltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrl
    avmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravleaev
    qmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklwsae
    ipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhg
    qvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvpmn
    rltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpv
    qyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyahamgn
    slggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfcmn
    glvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkpla
    sgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlae
    nlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqf
    trapldndiavseatridpnawverwkaaghyqaeaallqctadtladavlittahawqh
    qgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqe
    nypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysq
    qqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4duvB (B:)
    mggshhhhhhgmasmtggqqmgrdlyddddkdpmidpvvlqrrdwenpgvtqlnrlaahp
    pfaswrnseeartdrpsqqlrslngewrfawfpapeavpeswlecdlpeadtvvvpsnwq
    mhgydapiytnvtypitvnppfvptenptgcysltfnvdeswlqegqtriifdgvnsafh
    lwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrwsdgsyledqdmwrmsgifrd
    vsllhkpttqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgt
    apfggeiiderggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvg
    frevriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcsh
    ypnhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhp
    sviiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqp
    fpavpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwv
    dqslikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqqffqfrl
    sgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpelpqpesa
    gqlwltvrvvqpnatawseaghisawqqwrlaenlsvtlpaashaiphlttsemdfciel
    gnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapldndiavseatridpnawverwk
    aaghyqaeaallqctadtladavlittahawqhqgktlfisrktyridgsgqmaitvdve
    vasdtphpariglncqlaqvaervnwlglgpqenypdrltaacfdrwdlplsdmytpyvf
    psenglrcgtrelnygphqwrgdfqfnisrysqqqlmetshrhllhaeegtwlnidgfhm
    giggddswspsvsaefqlsagryhyqlvwcqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4duvB (B:)
    idpvvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpa
    peavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysl
    tfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrla
    vmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravleaevq
    mcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklwsaei
    pnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhgq
    vmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvpmnr
    ltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpvq
    yegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyahamgns
    lggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfcmng
    lvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkplas
    gevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlaen
    lsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqft
    rapldndiavseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhq
    gktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqen
    ypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqq
    qlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4duvC (C:)
    mggshhhhhhgmasmtggqqmgrdlyddddkdpmidpvvlqrrdwenpgvtqlnrlaahp
    pfaswrnseeartdrpsqqlrslngewrfawfpapeavpeswlecdlpeadtvvvpsnwq
    mhgydapiytnvtypitvnppfvptenptgcysltfnvdeswlqegqtriifdgvnsafh
    lwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrwsdgsyledqdmwrmsgifrd
    vsllhkpttqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgt
    apfggeiiderggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvg
    frevriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcsh
    ypnhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhp
    sviiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqp
    fpavpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwv
    dqslikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqqffqfrl
    sgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpelpqpesa
    gqlwltvrvvqpnatawseaghisawqqwrlaenlsvtlpaashaiphlttsemdfciel
    gnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapldndiavseatridpnawverwk
    aaghyqaeaallqctadtladavlittahawqhqgktlfisrktyridgsgqmaitvdve
    vasdtphpariglncqlaqvaervnwlglgpqenypdrltaacfdrwdlplsdmytpyvf
    psenglrcgtrelnygphqwrgdfqfnisrysqqqlmetshrhllhaeegtwlnidgfhm
    giggddswspsvsaefqlsagryhyqlvwcqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4duvC (C:)
    idpvvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpa
    peavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysl
    tfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrla
    vmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravleaevq
    mcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklwsaei
    pnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhgq
    vmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvpmnr
    ltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpvq
    yegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyahamgns
    lggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfcmng
    lvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkplas
    gevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlaen
    lsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqft
    rapldndiavseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhq
    gktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqen
    ypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqq
    qlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4duvD (D:)
    mggshhhhhhgmasmtggqqmgrdlyddddkdpmidpvvlqrrdwenpgvtqlnrlaahp
    pfaswrnseeartdrpsqqlrslngewrfawfpapeavpeswlecdlpeadtvvvpsnwq
    mhgydapiytnvtypitvnppfvptenptgcysltfnvdeswlqegqtriifdgvnsafh
    lwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrwsdgsyledqdmwrmsgifrd
    vsllhkpttqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgt
    apfggeiiderggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvg
    frevriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcsh
    ypnhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhp
    sviiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqp
    fpavpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwv
    dqslikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqqffqfrl
    sgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpelpqpesa
    gqlwltvrvvqpnatawseaghisawqqwrlaenlsvtlpaashaiphlttsemdfciel
    gnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapldndiavseatridpnawverwk
    aaghyqaeaallqctadtladavlittahawqhqgktlfisrktyridgsgqmaitvdve
    vasdtphpariglncqlaqvaervnwlglgpqenypdrltaacfdrwdlplsdmytpyvf
    psenglrcgtrelnygphqwrgdfqfnisrysqqqlmetshrhllhaeegtwlnidgfhm
    giggddswspsvsaefqlsagryhyqlvwcqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4duvD (D:)
    idpvvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpa
    peavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysl
    tfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrla
    vmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravleaevq
    mcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklwsaei
    pnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhgq
    vmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvpmnr
    ltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpvq
    yegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyahamgns
    lggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfcmng
    lvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkplas
    gevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlaen
    lsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqft
    rapldndiavseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhq
    gktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqen
    ypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqq
    qlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk