Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
Protein automated matches [254633] (4 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries) |
Domain d4duvd2: 4duv D:220-333 [251582] Other proteins in same PDB: d4duva1, d4duva3, d4duva5, d4duvb1, d4duvb3, d4duvb5, d4duvc1, d4duvc3, d4duvc5, d4duvd1, d4duvd3, d4duvd5 automated match to d1jz8a1 complexed with 2dg, btb, dms, mg, na |
PDB Entry: 4duv (more details), 2.1 Å
SCOPe Domain Sequences for d4duvd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4duvd2 b.1.4.0 (D:220-333) automated matches {Escherichia coli K-12 [TaxId: 83333]} tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d4duvd2:
View in 3D Domains from same chain: (mouse over for more information) d4duvd1, d4duvd3, d4duvd4, d4duvd5 |