![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) ![]() |
![]() | Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (15 proteins) |
![]() | Protein Staphylococcal enterotoxin A, SEA [50220] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [50221] (6 PDB entries) |
![]() | Domain d1i4ga1: 1i4g A:10-120 [25148] Other proteins in same PDB: d1i4ga2, d1i4gb2 complexed with so4, zn; mutant |
PDB Entry: 1i4g (more details), 2.1 Å
SCOPe Domain Sequences for d1i4ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i4ga1 b.40.2.2 (A:10-120) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus [TaxId: 1280]} kdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftdhswyndllv dfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt
Timeline for d1i4ga1: