SCOP 1.55: Domain d1i4ga1: 1i4g A:10-120

Lineage for d1i4ga1 (1i4g A:10-120)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.40: OB-fold [50198] (7 superfamilies)

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins)

6. Protein Staphylococcal enterotoxin A, SEA [50220] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50221] (4 PDB entries)

8. Domain d1i4ga1: 1i4g A:10-120 [25148]
   Other proteins in same PDB: d1i4ga2, d1i4gb2

Details for d1i4ga1

PDB Entry: 1i4g, 2.1 Å

PDB Description: crystal structure of staphylococcal enterotoxin a mutant h187a with reduced zn2+ affinity

SCOP Domain Sequences for d1i4ga1:

Sequence; same for both SEQRES and ATOM records:

>d1i4ga1 b.40.2.2 (A:10-120) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus}
kdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftdhswyndllv
dfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt

SCOP Domain Coordinates for d1i4ga1 are not available.

Timeline for d1i4ga1:

• d1i4ga1 appears in SCOP 1.57
  
• d1i4ga1 appears in the current release, SCOPe 2.08