Class a: All alpha proteins [46456] (290 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.0: automated matches [227298] (1 protein) not a true family |
Protein automated matches [227124] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226765] (9 PDB entries) |
Domain d4bcib2: 4bci B:151-259 [251202] Other proteins in same PDB: d4bcia_ automated match to d3mi9b2 complexed with t3e |
PDB Entry: 4bci (more details), 3.1 Å
SCOPe Domain Sequences for d4bcib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bcib2 a.74.1.0 (B:151-259) automated matches {Human (Homo sapiens) [TaxId: 9606]} dhphthvvkctqlvraskdlaqtsyfmatnslhlttfslqytppvvacvcihlackwsnw eipvstdgkhwweyvdatvtlelldelthellqilektpnrlkriwnwr
Timeline for d4bcib2: