PDB entry 4bci

View 4bci on RCSB PDB site
Description: Structure of CDK9 in complex with cyclin T and a 2-amino-4-heteroaryl- pyrimidine inhibitor
Class: transferase/cell cycle
Keywords: transferase-cell cycle complex, cdk-cyclin complex, transcription-protein binding, structure-based drug design
Deposited on 2012-10-02, released 2013-01-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-27, with a file datestamp of 2013-02-22.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.18
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyclin-dependent kinase 9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bcia_
  • Chain 'B':
    Compound: Cyclin-T1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60563 (Start-259)
      • engineered mutation (77)
      • engineered mutation (96)
      • engineered mutation (241)
    Domains in SCOPe 2.07: d4bcib1, d4bcib2
  • Heterogens: T3E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bciA (A:)
    gpakqydsvecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegf
    pitalreikilqllkhenvvnlieicrtkaspynrckgsiylvfdfcehdlagllsnvlv
    kftlseikrvmqmllnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslakn
    sqpnrytnrvvtlwyrppelllgerdygppidlwgagcimaemwtrspimqgnteqhqla
    lisqlcgsitpevwpnvdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvld
    paqridsddalnhdffwsdpmpsdlkgmlst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bciA (A:)
    ydsvecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpital
    reikilqllkhenvvnlieicrtgsiylvfdfcehdlagllsnvlvkftlseikrvmqml
    lnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslapnrytnrvvtlwyrpp
    elllgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgsitpevwpnvd
    nyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqridsddalnhdffws
    dpmpsdlkg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bciB (B:)
    gpegerknnnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqlti
    ntaivymhrfymiqsftrfpgnsvapaalflaakvegqpkklehvikvahtclhpqeslp
    dtrseaylqqvqdlvilesiilqtlgfeltidhphthvvkctqlvraskdlaqtsyfmat
    nslhlttfslqytppvvacvcihlackwsnweipvstdgkhwweyvdatvtlelldelth
    ellqilektpnrlkriwnwr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bciB (B:)
    nnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltintaivymh
    rfymiqsftrfpgnsvapaalflaakvegqpkklehvikvahtclhpqeslpdtrseayl
    qqvqdlvilesiilqtlgfeltidhphthvvkctqlvraskdlaqtsyfmatnslhlttf
    slqytppvvacvcihlackwsnweipvstdgkhwweyvdatvtlelldelthellqilek
    tpnrlkriwnwr